Anti-RPL3L

Catalog Number: ATA-HPA049136
Article Name: Anti-RPL3L
Biozol Catalog Number: ATA-HPA049136
Supplier Catalog Number: HPA049136
Alternative Catalog Number: ATA-HPA049136-100,ATA-HPA049136-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: RPL3L
ribosomal protein L3-like
Anti-RPL3L
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 6123
UniProt: Q92901
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GHGRFQTAQEKRAFMGPQKKHLEKETPETSGDL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RPL3L
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line PC-3 shows localization to nuclear speckles.
Immunohistochemistry analysis in human skeletal muscle and prostate tissues using Anti-RPL3L antibody. Corresponding RPL3L RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skeletal muscle shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
HPA049136-100ul
HPA049136-100ul
HPA049136-100ul