Anti-DHX8
Catalog Number:
ATA-HPA049285
- Images (8)
| Article Name: | Anti-DHX8 |
| Biozol Catalog Number: | ATA-HPA049285 |
| Supplier Catalog Number: | HPA049285 |
| Alternative Catalog Number: | ATA-HPA049285-100,ATA-HPA049285-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DDX8, HRH1, PRP22, PRPF22 |
| DEAH (Asp-Glu-Ala-His) box polypeptide 8 |
| Anti-DHX8 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 1659 |
| UniProt: | Q14562 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PDGSLSQAAMMQSALAKERRELKQAQREAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQMSILEQRESLP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DHX8 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm & nuclear bodies. |
|
|
Immunohistochemical staining of human cerebellum shows strong cytoplasmic and nucleaolar positivity in Purkinje cells. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-DHX8 antibody. Remaining relative intensity is presented. |
|
|
HPA049285-100ul |
|
|
|
|
|
|
|
|
HPA049285-100ul |
|
|
HPA049285-100ul |
Product Guarantee and Expert Support
