Anti-NCAPG2

Catalog Number: ATA-HPA049637
Article Name: Anti-NCAPG2
Biozol Catalog Number: ATA-HPA049637
Supplier Catalog Number: HPA049637
Alternative Catalog Number: ATA-HPA049637-100,ATA-HPA049637-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CAP-G2, FLJ20311, hCAP-G2, LUZP5, MTB
Clonality: Polyclonal
Isotype: IgG
NCBI: 54892
UniProt: Q86XI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DGREKENVTVLDKTLSVNDVACMAGLLEIIVILWKSIDRSMENNKEAKLYTINKFASVLPEYLKVFKDDRCKIPLFMLMSFMPASAVPPFSCGVISTLR
Target: NCAPG2
Antibody Type: Monoclonal Antibody
HPA049637-100ul