Anti-CNNM4

Catalog Number: ATA-HPA049706
Article Name: Anti-CNNM4
Biozol Catalog Number: ATA-HPA049706
Supplier Catalog Number: HPA049706
Alternative Catalog Number: ATA-HPA049706-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: WB
Species Reactivity: Human
Alternative Names: ACDP4, KIAA1592
Rabbit Polyclonal CNNM4 Antibody against Human cyclin and CBS domain divalent metal cation transport mediator 4. Validated for Western Blot
Clonality: Polyclonal
Concentration: 0.05
NCBI: 26504
UniProt: Q6P4Q7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Sequence: RLASCNKSCGTNPDGIIFVSEGSTVNLRLYGYSLGNISSNLISFTEVDDAETLHKSTSCLELTKDLVVQQLVNVSRGNTSGVLVVLTKFLRRSESMKLYALCTRAQPDGPWLKWTDKDSLLFMV
WB Image Caption 1