Anti-CNNM4, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CNNM4, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA049706
• Supplier Catalog Number: HPA049706
• Alternative Catalog Number: ATA-HPA049706-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: ACDP4, KIAA1592

Product Description

Rabbit Polyclonal CNNM4 Antibody against Human cyclin and CBS domain divalent metal cation transport mediator 4. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05
• NCBI: 26504
• UniProt: Q6P4Q7
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: RLASCNKSCGTNPDGIIFVSEGSTVNLRLYGYSLGNISSNLISFTEVDDAETLHKSTSCLELTKDLVVQQLVNVSRGNTSGVLVVLTKFLRRSESMKLYALCTRAQPDGPWLKWTDKDSLLFMV