Anti-SCUBE3
Catalog Number:
ATA-HPA049734
| Article Name: |
Anti-SCUBE3 |
| Biozol Catalog Number: |
ATA-HPA049734 |
| Supplier Catalog Number: |
HPA049734 |
| Alternative Catalog Number: |
ATA-HPA049734-100,ATA-HPA049734-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
CEGF3, FLJ34743 |
| Rabbit Polyclonal SCUBE3 Antibody against Human signal peptide, CUB domain and EGF like domain containing 3. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.3 |
| NCBI: |
222663 |
| UniProt: |
Q8IX30 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
LRQRMERRLKGSLKMLRKSINQDRFLLRLAGLDYELAHKPGLVAGERAEPMESCRPGQHRAGTKCVSCPQGTYYHGQTEQCVPCP |
|
WB Image Caption 1 |