Anti-LBR
Catalog Number:
ATA-HPA049840
- Images (8)
| Article Name: | Anti-LBR |
| Biozol Catalog Number: | ATA-HPA049840 |
| Supplier Catalog Number: | HPA049840 |
| Alternative Catalog Number: | ATA-HPA049840-100,ATA-HPA049840-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DHCR14B, TDRD18 |
| lamin B receptor |
| Anti-LBR |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 3930 |
| UniProt: | Q14739 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MPSRKFADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDIKPLTSFRQRKGGSTSSS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LBR |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using HPA049840 antibody. Corresponding LBR RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human small intestine shows strong positivity in nuclear membrane in glandular cells. |
|
|
Immunohistochemical staining of human testis shows strong positivity in nuclear membrane in subset of cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human lymph node shows moderate to strong positivity in nuclear membrane. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA049840-100ul |
|
|
HPA049840-100ul |
|
|
HPA049840-100ul |
Product Guarantee and Expert Support
