Anti-GAL
Catalog Number:
ATA-HPA049864
- Images (9)
| Article Name: | Anti-GAL |
| Biozol Catalog Number: | ATA-HPA049864 |
| Supplier Catalog Number: | HPA049864 |
| Alternative Catalog Number: | ATA-HPA049864-100,ATA-HPA049864-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | GAL-GMAP, GALN, GLNN, GMAP |
| galanin/GMAP prepropeptide |
| Anti-GAL |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 51083 |
| UniProt: | P22466 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GAL |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles. |
|
|
Immunohistochemistry analysis in human appendix and cerebral cortex tissues using Anti-GAL antibody. Corresponding GAL RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human appendix shows high expression. |
|
|
Immunohistochemical staining of human anterior pituitary gland shows strong cytoplasmic positivity in subsets of endocrine cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
HPA049864-100ul |
|
|
|
|
|
HPA049864-100ul |
|
|
HPA049864-100ul |
Product Guarantee and Expert Support
