Anti-GTSE1
Catalog Number:
ATA-HPA049873
| Article Name: |
Anti-GTSE1 |
| Biozol Catalog Number: |
ATA-HPA049873 |
| Supplier Catalog Number: |
HPA049873 |
| Alternative Catalog Number: |
ATA-HPA049873-100,ATA-HPA049873-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
B99, GTSE-1, Lnc_bc060912 |
| Rabbit Polyclonal GTSE1 Antibody against Human G2 and S-phase expressed 1. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.1 |
| NCBI: |
51512 |
| UniProt: |
Q9NYZ3 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
IPASPSRTKIPAEKESHRDVLPDKPAPGAVNVPAAGSHLGQGKRAIPVPNKLGLKKTLLKAPGSTSNLARKSSSGPVWSGASSACTSPAVGKAKSSE |