Anti-GTSE1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-GTSE1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA049873
• Supplier Catalog Number: HPA049873
• Alternative Catalog Number: ATA-HPA049873-100,ATA-HPA049873-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: B99, GTSE-1, Lnc_bc060912

Product Description

Rabbit Polyclonal GTSE1 Antibody against Human G2 and S-phase expressed 1. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1
• NCBI: 51512
• UniProt: Q9NYZ3
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: IPASPSRTKIPAEKESHRDVLPDKPAPGAVNVPAAGSHLGQGKRAIPVPNKLGLKKTLLKAPGSTSNLARKSSSGPVWSGASSACTSPAVGKAKSSE