Anti-GTSE1

Catalog Number: ATA-HPA049873
Article Name: Anti-GTSE1
Biozol Catalog Number: ATA-HPA049873
Supplier Catalog Number: HPA049873
Alternative Catalog Number: ATA-HPA049873-100,ATA-HPA049873-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: WB
Species Reactivity: Human
Alternative Names: B99, GTSE-1, Lnc_bc060912
Rabbit Polyclonal GTSE1 Antibody against Human G2 and S-phase expressed 1. Validated for Western Blot
Clonality: Polyclonal
Concentration: 0.1
NCBI: 51512
UniProt: Q9NYZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Sequence: IPASPSRTKIPAEKESHRDVLPDKPAPGAVNVPAAGSHLGQGKRAIPVPNKLGLKKTLLKAPGSTSNLARKSSSGPVWSGASSACTSPAVGKAKSSE