Anti-TOX2, Rabbit, Polyclonal
Catalog Number:
ATA-HPA049900
- Images (9)
| Article Name: | Anti-TOX2, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA049900 |
| Supplier Catalog Number: | HPA049900 |
| Alternative Catalog Number: | ATA-HPA049900-25,ATA-HPA049900-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C20orf100, dJ1108D11.2, GCX-1 |
| TOX high mobility group box family member 2 |
| Anti-TOX2 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 84969 |
| UniProt: | Q96NM4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | IAGVFPQKFDGDSAYVGMSDGNPELLSTSQTYNGQSENNEDYEIPPITPPN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TOX2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
|
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using HPA049900 antibody. Corresponding TOX2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node shows strong nuclear positivity in germinal center cells. |
|
|
Immunohistochemical staining of human tonsil shows strong nuclear positivity in germinal center cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
|
|
|
HPA049900 |
|
|
HPA049900 |
|
|
HPA049900 |
Product Guarantee and Expert Support
