Anti-TOX2

Catalog Number: ATA-HPA049900
Article Name: Anti-TOX2
Biozol Catalog Number: ATA-HPA049900
Supplier Catalog Number: HPA049900
Alternative Catalog Number: ATA-HPA049900-100,ATA-HPA049900-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C20orf100, dJ1108D11.2, GCX-1
TOX high mobility group box family member 2
Anti-TOX2
Clonality: Polyclonal
Isotype: IgG
NCBI: 84969
UniProt: Q96NM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IAGVFPQKFDGDSAYVGMSDGNPELLSTSQTYNGQSENNEDYEIPPITPPN
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TOX2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using HPA049900 antibody. Corresponding TOX2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lymph node shows strong nuclear positivity in germinal center cells.
Immunohistochemical staining of human tonsil shows strong nuclear positivity in germinal center cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
HPA049900-100ul
HPA049900-100ul
HPA049900-100ul