Anti-SERPINE1, Rabbit, Polyclonal
Catalog Number:
ATA-HPA050039
- Images (9)
| Article Name: | Anti-SERPINE1, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA050039 |
| Supplier Catalog Number: | HPA050039 |
| Alternative Catalog Number: | ATA-HPA050039-25,ATA-HPA050039-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PAI, PAI1, PLANH1, Pan-Cancer |
| serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1 |
| Anti-SERPINE1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 5054 |
| UniProt: | P05121 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFRQFQADF |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SERPINE1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol. |
|
|
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in a subset of squamous epithelial cells. |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in endothelial cells. |
|
|
Immunohistochemical staining of human urinary bladder shows moderate cytoplasmic positivity in a subset of urothelial cells. |
|
|
Immunohistochemical staining of human colon shows moderate to strong cytoplasmic positivity in endothelial cells. |
|
|
HPA050039 |
|
|
|
|
|
HPA050039 |
|
|
HPA050039 |
Product Guarantee and Expert Support
