Anti-DYNLT4

Catalog Number: ATA-HPA050116
Article Name: Anti-DYNLT4
Biozol Catalog Number: ATA-HPA050116
Supplier Catalog Number: HPA050116
Alternative Catalog Number: ATA-HPA050116-100,ATA-HPA050116-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: TCTEX1D4
Clonality: Polyclonal
Concentration: 0,1
NCBI: 343521
UniProt: Q5JR98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LVRELCEQVHVRLRELSPPRYKLVCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYCE
Target: DYNLT4
HPA050116-100ul