Anti-LRRD1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-LRRD1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA050174
• Supplier Catalog Number: HPA050174
• Alternative Catalog Number: ATA-HPA050174-100,ATA-HPA050174-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: IMAGE:4798971

Product Description

Rabbit Polyclonal LRRD1 Antibody against Human leucine rich repeats and death domain containing 1. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2
• NCBI: 401387
• UniProt: A4D1F6
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: MTQLKELDISNNAIREIPRNIGELRNLVSLHAYNNQISY