Anti-RPL28

Catalog Number: ATA-HPA050459
Article Name: Anti-RPL28
Biozol Catalog Number: ATA-HPA050459
Supplier Catalog Number: HPA050459
Alternative Catalog Number: ATA-HPA050459-100,ATA-HPA050459-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ43307, L28
ribosomal protein L28
Anti-RPL28
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 6158
UniProt: P46779
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRSQKPVMVKRKRT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RPL28
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line MCF7 shows localization to cytosol & endoplasmic reticulum.
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RPL28 antibody. Remaining relative intensity is presented.
HPA050459-100ul
HPA050459-100ul
HPA050459-100ul