Anti-LMNB1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA050524
Article Name: Anti-LMNB1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA050524
Supplier Catalog Number: HPA050524
Alternative Catalog Number: ATA-HPA050524-100,ATA-HPA050524-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: LMNB1
lamin B1
Anti-LMNB1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 4001
UniProt: P20700
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: LMNB1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line MCF7 shows localization to nuclear membrane.
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using HPA050524 antibody. Corresponding LMNB1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lymph node shows moderate to strong positivity in nuclear membrane in non-germinal center cells.
Immunohistochemical staining of human skin shows moderate to strong positivity in nuclear membrane in keratinocytes.
Immunohistochemical staining of human small intestine shows moderate to strong positivity in nuclear membrane in glandular cells.
Immunohistochemical staining of human skeletal muscle shows moderate to strong positivity in nuclear membrane in myocytes.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Lane 4: Human plasma
Lane 5: Human Liver tissue
Lane 6: Human Tonsil tissue
HPA050524
HPA050524
HPA050524