Anti-UNC80

Catalog Number: ATA-HPA050959
Article Name: Anti-UNC80
Biozol Catalog Number: ATA-HPA050959
Supplier Catalog Number: HPA050959
Alternative Catalog Number: ATA-HPA050959-100,ATA-HPA050959-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C2orf21, FLJ33496, KIAA1843, UNC-80
Clonality: Polyclonal
Isotype: IgG
NCBI: 285175
UniProt: Q8N2C7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KLGKQYEASCVSFERVLVENKLHGLSPALSEAIQSISRWELVQAALPHVLHCTATLLSNRNKLGHQDKLGVAETKLLHTLHWML
Target: UNC80
Antibody Type: Monoclonal Antibody
HPA050959-100ul