Anti-ZNF524

Catalog Number: ATA-HPA050981
Article Name: Anti-ZNF524
Biozol Catalog Number: ATA-HPA050981
Supplier Catalog Number: HPA050981
Alternative Catalog Number: ATA-HPA050981-100,ATA-HPA050981-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ChIP, ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC23143
zinc finger protein 524
Anti-ZNF524
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 147807
UniProt: Q96C55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: CRLRFTEANTLRRHAKRKHPEAMGVPLCAPDPGSEPPWDEEGIPATA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ZNF524
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and ZNF524 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407148).
HPA050981-100ul
HPA050981-100ul
HPA050981
HPA050981-100ul