Anti-ATAT1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA050999
Article Name: Anti-ATAT1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA050999
Supplier Catalog Number: HPA050999
Alternative Catalog Number: ATA-HPA050999-100,ATA-HPA050999-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C6orf134, Em:AB023049.7, FLJ13158, MEC17
Clonality: Polyclonal
NCBI: 79969
UniProt: Q5SQI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QQIMTIIDELGKASAKAQNLSAPITSASRMQSNRHVVYILKDSSARPAGKGAIIGFIKVGYKKLFVLDDR
Target: ATAT1