Anti-FBXW9, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-FBXW9, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA051030
• Supplier Catalog Number: HPA051030
• Alternative Catalog Number: ATA-HPA051030-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: Fbw9, MGC10870

Product Description

Rabbit Polyclonal FBXW9 Antibody against Human F-box and WD repeat domain containing 9. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05
• NCBI: 84261
• UniProt: Q5XUX1
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: MELPLGRCDDSRTWDDDSDPESETDPDAQAKAYVARVLSPPKSGLAFSRPSQLSTPAASPSASEPRAASRVSAVSEPG