Anti-FBXW9

Catalog Number: ATA-HPA051030
Article Name: Anti-FBXW9
Biozol Catalog Number: ATA-HPA051030
Supplier Catalog Number: HPA051030
Alternative Catalog Number: ATA-HPA051030-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Alternative Names: Fbw9, MGC10870
Rabbit Polyclonal FBXW9 Antibody against Human F-box and WD repeat domain containing 9. Validated for Western Blot
Clonality: Polyclonal
Concentration: 0.05
NCBI: 84261
UniProt: Q5XUX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Sequence: MELPLGRCDDSRTWDDDSDPESETDPDAQAKAYVARVLSPPKSGLAFSRPSQLSTPAASPSASEPRAASRVSAVSEPG
WB Image Caption 1