Anti-OTULIN
Catalog Number:
ATA-HPA051074
- Images (8)
| Article Name: | Anti-OTULIN |
| Biozol Catalog Number: | ATA-HPA051074 |
| Supplier Catalog Number: | HPA051074 |
| Alternative Catalog Number: | ATA-HPA051074-100,ATA-HPA051074-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FAM105B, FLJ34884 |
| OTU deubiquitinase with linear linkage specificity |
| Anti-OTULIN |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 90268 |
| UniProt: | Q96BN8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DEIEKEKELLIHERGASEPRLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKFTSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMLLP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | OTULIN |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & mitochondria. |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules. |
|
|
Western blot analysis in human cell lines HeLa and MCF-7 using Anti-OTULIN antibody. Corresponding OTULIN RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
HPA051074-100ul |
|
|
|
|
|
|
|
|
HPA051074-100ul |
|
|
HPA051074-100ul |
Product Guarantee and Expert Support
