Anti-MINDY2

Catalog Number: ATA-HPA051103
Article Name: Anti-MINDY2
Biozol Catalog Number: ATA-HPA051103
Supplier Catalog Number: HPA051103
Alternative Catalog Number: ATA-HPA051103-100,ATA-HPA051103-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FAM63B, KIAA1164
MINDY lysine 48 deubiquitinase 2
Anti-MINDY2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 54629
UniProt: Q8NBR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SPPGESPSLDSLESFSNLHSFPSSCEFNSEEGAENRVPEEEEGAAVLPGAVPLCKEEEGEETAQVLAASKERFPGQSVYHIKWIQWKE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MINDY2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in distal tubules.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA051103-100ul
HPA051103-100ul
HPA051103-100ul