Anti-CYP19A1

Catalog Number: ATA-HPA051194
Article Name: Anti-CYP19A1
Biozol Catalog Number: ATA-HPA051194
Supplier Catalog Number: HPA051194
Alternative Catalog Number: ATA-HPA051194-100,ATA-HPA051194-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ARO, ARO1, aromatase, CPV1, CYAR, CYP19, P-450AROM
cytochrome P450, family 19, subfamily A, polypeptide 1
Anti-CYP19A1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 1588
UniProt: P11511
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IGERDIKIDDIQKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CYP19A1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line ASC TERT1 shows localization to mitochondria.
Immunohistochemistry analysis in human placenta and prostate tissues using Anti-CYP19A1 antibody. Corresponding CYP19A1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
HPA051194-100ul
HPA051194-100ul
HPA051194-100ul