Anti-PRDM5

Catalog Number: ATA-HPA051406
Article Name: Anti-PRDM5
Biozol Catalog Number: ATA-HPA051406
Supplier Catalog Number: HPA051406
Alternative Catalog Number: ATA-HPA051406-100,ATA-HPA051406-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PFM2
PR domain containing 5
Anti-PRDM5
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Isotype: IgG
NCBI: 11107
UniProt: Q9NQX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GDARFVCKADSCGKRLKSKDALKRHQENVHTGDPKKKLICSVCNKKCSSASSLQEHRKIHEIFDCQECMKK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PRDM5
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line RH-30 shows localization to nucleus, nucleoli & nuclear bodies.
Immunohistochemistry analysis in human endometrium and liver tissues using Anti-PRDM5 antibody. Corresponding PRDM5 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human endometrium shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
HPA051406-100ul
HPA051406-100ul
HPA051406-100ul