Anti-RIOK1

Catalog Number: ATA-HPA051446
Article Name: Anti-RIOK1
Biozol Catalog Number: ATA-HPA051446
Supplier Catalog Number: HPA051446
Alternative Catalog Number: ATA-HPA051446-100,ATA-HPA051446-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: AD034, bA288G3.1, FLJ30006, RRP10
RIO kinase 1
Anti-RIOK1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 83732
UniProt: Q9BRS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DWDWDEGVGKLAKGYVWNGGSNPQANRQTSDSSSAKMSTPADKVLRKFENKINLDKLNVTDSVINKVTEKSRQKEADMYRIKD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RIOK1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line PC-3 shows localization to nucleoli, nuclear speckles & cytosol.
Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-RIOK1 antibody. Corresponding RIOK1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemical staining of human testis shows high expression.
HPA051446-100ul
HPA051446-100ul
HPA051446-100ul