Anti-ZNF513 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA051493
- Images (0)
| Article Name: | Anti-ZNF513 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA051493 |
| Supplier Catalog Number: | HPA051493 |
| Alternative Catalog Number: | ATA-HPA051493-100, ATA-HPA051493-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ32203, RP58 |
| Clonality: | Polyclonal |
| NCBI: | 130557 |
| UniProt: | Q8N8E2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LPELLFPWTCRGCGQELEEGEGSRLGAAMCGRCMRGEAGGGASGGPQGPSDKGFACSLCPFATHYPNHLARHMK |
| Target: | ZNF513 |
Product Guarantee and Expert Support
