Anti-HTT

Catalog Number: ATA-HPA051524
Article Name: Anti-HTT
Biozol Catalog Number: ATA-HPA051524
Supplier Catalog Number: HPA051524
Alternative Catalog Number: ATA-HPA051524-100,ATA-HPA051524-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HD, IT15
Clonality: Polyclonal
Concentration: 0,5
NCBI: 3064
UniProt: P42858
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DWYVHLVKSQCWTRSDSALLEGAELVNRIPAEDMNAFMMNSEFNLSLLAPCLSLGMSEISGGQKSALFEAAREVTLARVSGTVQQLPAVHHVFQPELPAEPAAYWSKLNDLFGDAALYQSLPTLARALAQYLVVVSKLPSH
Target: HTT
HPA051524-100ul