Anti-RASEF, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-RASEF, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA051606
• Supplier Catalog Number: HPA051606
• Alternative Catalog Number: ATA-HPA051606-100,ATA-HPA051606-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: FLJ31614, RAB45

Product Description

Rabbit Polyclonal RASEF Antibody against Human RAS and EF-hand domain containing. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1
• NCBI: 158158
• UniProt: Q8IZ41
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: GLSTLRDPNEYDSEVEYKHQRGFQRSHGVQESFGGDASDTDVPDIRDEETFGLEDVASVLDWKPQGSVSEGSIVSSSRKPISAL