Anti-RASEF
Catalog Number:
ATA-HPA051606
| Article Name: |
Anti-RASEF |
| Biozol Catalog Number: |
ATA-HPA051606 |
| Supplier Catalog Number: |
HPA051606 |
| Alternative Catalog Number: |
ATA-HPA051606-100,ATA-HPA051606-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
FLJ31614, RAB45 |
| Rabbit Polyclonal RASEF Antibody against Human RAS and EF-hand domain containing. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.1 |
| NCBI: |
158158 |
| UniProt: |
Q8IZ41 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
GLSTLRDPNEYDSEVEYKHQRGFQRSHGVQESFGGDASDTDVPDIRDEETFGLEDVASVLDWKPQGSVSEGSIVSSSRKPISAL |
|
WB Image Caption 1 |