Anti-SLC5A1
Catalog Number:
ATA-HPA051805
- Images (7)
| Article Name: | Anti-SLC5A1 |
| Biozol Catalog Number: | ATA-HPA051805 |
| Supplier Catalog Number: | HPA051805 |
| Alternative Catalog Number: | ATA-HPA051805-100,ATA-HPA051805-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | D22S675, NAGT, SGLT1 |
| solute carrier family 5 (sodium/glucose cotransporter), member 1 |
| Anti-SLC5A1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 6523 |
| UniProt: | P13866 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DLDAEEENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC5A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human duodenum and liver tissues using Anti-SLC5A1 antibody. Corresponding SLC5A1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human duodenum shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 |
|
|
HPA051805-100ul |
|
|
HPA051805-100ul |
|
|
HPA051805-100ul |
Product Guarantee and Expert Support
