Anti-TMEM119
Catalog Number:
ATA-HPA051870
- Images (8)
| Article Name: | Anti-TMEM119 |
| Biozol Catalog Number: | ATA-HPA051870 |
| Supplier Catalog Number: | HPA051870 |
| Alternative Catalog Number: | ATA-HPA051870-100,ATA-HPA051870-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | TMEM119 |
| transmembrane protein 119 |
| Anti-TMEM119 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 338773 |
| UniProt: | Q4V9L6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TMEM119 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human cerebral cortex, liver, lymph node and testis using Anti-TMEM119 antibody HPA051870 (A) shows similar protein distribution across tissues to independent antibody HPA052650 (B). |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate membranous positivity in microglia. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human lymph node strong positivity in reticular fibers in germinal center cells. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in peritubular myoid cells. |
|
|
HPA051870-100ul |
|
|
HPA051870-100ul |
|
|
HPA051870-100ul |
Product Guarantee and Expert Support
