Anti-RTEL1
Catalog Number:
ATA-HPA052104
| Article Name: |
Anti-RTEL1 |
| Biozol Catalog Number: |
ATA-HPA052104 |
| Supplier Catalog Number: |
HPA052104 |
| Alternative Catalog Number: |
ATA-HPA052104-100 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
bK3184A7.3, C20orf41, DKFZP434C013, KIAA1088, NHL, RTEL |
| Rabbit Polyclonal RTEL1 Antibody against Human regulator of telomere elongation helicase 1. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.05 |
| NCBI: |
51750 |
| UniProt: |
Q9NZ71 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
VFTNTAGLQKLADIIQIVFSVDPSEGSPGSPAGLGALQSYKVHIHPDAGHRRTAQRSDAWSTTAARKRGKVLSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPFPVCLENPHIIDKHQIWV |
|
WB Image Caption 1 |