Anti-RTEL1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-RTEL1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA052104
• Supplier Catalog Number: HPA052104
• Alternative Catalog Number: ATA-HPA052104-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: bK3184A7.3, C20orf41, DKFZP434C013, KIAA1088, NHL, RTEL

Product Description

Rabbit Polyclonal RTEL1 Antibody against Human regulator of telomere elongation helicase 1. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05
• NCBI: 51750
• UniProt: Q9NZ71
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: VFTNTAGLQKLADIIQIVFSVDPSEGSPGSPAGLGALQSYKVHIHPDAGHRRTAQRSDAWSTTAARKRGKVLSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPFPVCLENPHIIDKHQIWV