Anti-SHOC1

Catalog Number: ATA-HPA052214
Article Name: Anti-SHOC1
Biozol Catalog Number: ATA-HPA052214
Supplier Catalog Number: HPA052214
Alternative Catalog Number: ATA-HPA052214-100,ATA-HPA052214-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C9orf84, FLJ32779, MZIP2, Zip2
Clonality: Polyclonal
Concentration: 0,3
NCBI: 158401
UniProt: Q5VXU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LTNKHGIEDIGDIKFSSTEILTIQSQSEPEECSKPGELEMPLTPLFLTCQHSSVNSLRTELQTFPLSPVCKI
Target: SHOC1
HPA052214-100ul