Anti-GCKR

Catalog Number: ATA-HPA052227
Article Name: Anti-GCKR
Biozol Catalog Number: ATA-HPA052227
Supplier Catalog Number: HPA052227
Alternative Catalog Number: ATA-HPA052227-100,ATA-HPA052227-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 2646
UniProt: Q14397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVSFNQLMKGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGISVGLSAPFVAGQMDCCMNNTAVFLPVLV
Target: GCKR
Antibody Type: Monoclonal Antibody
HPA052227-100ul