Anti-ARPC2

Catalog Number: ATA-HPA052703
Article Name: Anti-ARPC2
Biozol Catalog Number: ATA-HPA052703
Supplier Catalog Number: HPA052703
Alternative Catalog Number: ATA-HPA052703-100,ATA-HPA052703-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ARC34, p34-Arc
Clonality: Polyclonal
Isotype: IgG
NCBI: 10109
UniProt: O15144
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHY
Target: ARPC2
Antibody Type: Monoclonal Antibody
HPA052703-100ul