Anti-FNIP2

Catalog Number: ATA-HPA052758
Article Name: Anti-FNIP2
Biozol Catalog Number: ATA-HPA052758
Supplier Catalog Number: HPA052758
Alternative Catalog Number: ATA-HPA052758-100,ATA-HPA052758-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FNIPL, KIAA1450, MAPO1
Clonality: Polyclonal
Isotype: IgG
NCBI: 57600
UniProt: Q9P278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GFQENVCCPQNRLSEGDEGESDKGFAEDRGSRNDMAADIAGQLSHAADLGTASHGAGGTGGRRLEATRGLYVKAAEGPVLE
Target: FNIP2
Antibody Type: Monoclonal Antibody
HPA052758-100ul