Anti-PALM3

Catalog Number: ATA-HPA052794
Article Name: Anti-PALM3
Biozol Catalog Number: ATA-HPA052794
Supplier Catalog Number: HPA052794
Alternative Catalog Number: ATA-HPA052794-100,ATA-HPA052794-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PALM3
paralemmin 3
Anti-PALM3
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 342979
UniProt: A6NDB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DPTSKDPQSPEGQAQARIRNLEDSLFTLQSQLQLLQSASTGAQHKPSGRPSWRRQGHRPLSQSIV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PALM3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & nuclear bodies.
Immunohistochemistry analysis in human kidney and skeletal muscle tissues using Anti-PALM3 antibody. Corresponding PALM3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
HPA052794-100ul
HPA052794-100ul
HPA052794-100ul