Anti-ITPKC

Catalog Number: ATA-HPA053003
Article Name: Anti-ITPKC
Biozol Catalog Number: ATA-HPA053003
Supplier Catalog Number: HPA053003
Alternative Catalog Number: ATA-HPA053003-100,ATA-HPA053003-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: IP3-3KC, IP3KC
inositol-trisphosphate 3-kinase C
Anti-ITPKC
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 80271
UniProt: Q96DU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QIQQDTDGSWTQPSTDGSQTAPGTDCLLGEPEDGPLEEPEPGELLTHLYSHLKCSPLCPVPRLIITPETPEPEAQPVGPPSRVEGGSGGFSSASSFDESE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ITPKC
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA053003-100ul
HPA053003-100ul
HPA053003-100ul