Anti-HSPB9

Catalog Number: ATA-HPA053091
Article Name: Anti-HSPB9
Biozol Catalog Number: ATA-HPA053091
Supplier Catalog Number: HPA053091
Alternative Catalog Number: ATA-HPA053091-100,ATA-HPA053091-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CT51
Clonality: Polyclonal
Concentration: 0,2
NCBI: 94086
UniProt: Q9BQS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQCVALALPEAQTGPSPRLGSLGSKASNLTR
Target: HSPB9
HPA053091-100ul