Anti-TESC
Catalog Number:
ATA-HPA053200
- Images (8)
| Article Name: | Anti-TESC |
| Biozol Catalog Number: | ATA-HPA053200 |
| Supplier Catalog Number: | HPA053200 |
| Alternative Catalog Number: | ATA-HPA053200-100,ATA-HPA053200-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CHP3, FLJ20607, TSC |
| tescalcin |
| Anti-TESC |
| Clonality: | Polyclonal |
| Concentration: | 0.8 mg/ml |
| Isotype: | IgG |
| NCBI: | 54997 |
| UniProt: | Q96BS2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYDSDSDGRITLEEYRNVV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TESC |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500 |
|
|
Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemistry analysis in human salivary gland and colon tissues using Anti-TESC antibody. Corresponding TESC RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human salivary gland shows high expression. |
|
|
Immunohistochemical staining of human colon shows low expression as expected. |
|
|
HPA053200-100ul |
|
|
|
|
|
HPA053200-100ul |
|
|
HPA053200-100ul |
Product Guarantee and Expert Support
