Anti-TIMMDC1

Catalog Number: ATA-HPA053214
Article Name: Anti-TIMMDC1
Biozol Catalog Number: ATA-HPA053214
Supplier Catalog Number: HPA053214
Alternative Catalog Number: ATA-HPA053214-100,ATA-HPA053214-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C3orf1, FLJ22597
translocase of inner mitochondrial membrane domain containing 1
Anti-TIMMDC1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 51300
UniProt: Q9NPL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TIMMDC1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & mitochondria.
Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
HPA053214-100ul
HPA053214-100ul
HPA053214-100ul