Anti-FCHSD1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-FCHSD1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA053333
• Supplier Catalog Number: HPA053333
• Alternative Catalog Number: ATA-HPA053333-100,ATA-HPA053333-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: FLJ00007

Product Description

Rabbit Polyclonal FCHSD1 Antibody against Human FCH and double SH3 domains 1. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1
• NCBI: 89848
• UniProt: Q86WN1
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: RLSEARLSQRDLSPTAEDAELSDFEECEETGELFEEPAPQALATRALPCPAHVVFRYQAGREDELTITEGEWLEVIEEGDADEWV