Anti-TREM1

Catalog Number: ATA-HPA053612
Article Name: Anti-TREM1
Biozol Catalog Number: ATA-HPA053612
Supplier Catalog Number: HPA053612
Alternative Catalog Number: ATA-HPA053612-100,ATA-HPA053612-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CD354, TREM-1
Clonality: Polyclonal
Isotype: IgG
NCBI: 54210
UniProt: Q9NP99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRL
Target: TREM1
Antibody Type: Monoclonal Antibody
HPA053612-100ul