Anti-PHOX2A

Catalog Number: ATA-HPA053810
Article Name: Anti-PHOX2A
Biozol Catalog Number: ATA-HPA053810
Supplier Catalog Number: HPA053810
Alternative Catalog Number: ATA-HPA053810-100,ATA-HPA053810-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ARIX, CFEOM2, FEOM2, PMX2A
Clonality: Polyclonal
Isotype: IgG
NCBI: 401
UniProt: O14813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPY
Target: PHOX2A
Antibody Type: Monoclonal Antibody
HPA053810-100ul