Anti-HMCN2

Catalog Number: ATA-HPA053903
Article Name: Anti-HMCN2
Biozol Catalog Number: ATA-HPA053903
Supplier Catalog Number: HPA053903
Alternative Catalog Number: ATA-HPA053903-100,ATA-HPA053903-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp434P0216, FLJ23816
hemicentin 2
Anti-HMCN2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 256158
UniProt: Q8NDA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FSTQPLLDLNHTLEWPLQGVPISLVINSTGLKAPGRLDSVELAQSSGKPLLTLPTKPLSNGSTHQLWGGPPFHTPKERFYLKVKGKDHE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: HMCN2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry analysis in human small intestine and liver tissues using Anti-HMCN2 antibody. Corresponding HMCN2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human small intestine shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
HPA053903-100ul
HPA053903-100ul
HPA053903-100ul