Anti-FCAMR, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-FCAMR, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA054043
• Supplier Catalog Number: HPA054043
• Alternative Catalog Number: ATA-HPA054043-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: CD351, FCA/MR, FKSG87

Product Description

Rabbit Polyclonal FCAMR Antibody against Human Fc alpha and mu receptor. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05
• NCBI: 83953
• UniProt: Q8WWV6
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: SAEGRRTPGATRPAAPGTGSWAEGSVKAPAPIPESPPSKSRSMSNTTEGVWEGTRSSVTNRARASKDRREMTTTKADRPREEIE