Anti-BCAT2
Catalog Number:
ATA-HPA054091
- Images (8)
| Article Name: | Anti-BCAT2 |
| Biozol Catalog Number: | ATA-HPA054091 |
| Supplier Catalog Number: | HPA054091 |
| Alternative Catalog Number: | ATA-HPA054091-100,ATA-HPA054091-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BCAM, BCT2 |
| branched chain amino-acid transaminase 2, mitochondrial |
| Anti-BCAT2 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 587 |
| UniProt: | O15382 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHML |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | BCAT2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human adrenal gland and liver tissues using Anti-BCAT2 antibody. Corresponding BCAT2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human adrenal gland shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 |
|
|
|
|
|
HPA054091-100ul |
|
|
HPA054091-100ul |
|
|
HPA054091-100ul |
Product Guarantee and Expert Support
