Anti-COMMD10

Catalog Number: ATA-HPA054156
Article Name: Anti-COMMD10
Biozol Catalog Number: ATA-HPA054156
Supplier Catalog Number: HPA054156
Alternative Catalog Number: ATA-HPA054156-100,ATA-HPA054156-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PTD002
Clonality: Polyclonal
Isotype: IgG
NCBI: 51397
UniProt: Q9Y6G5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQ
Target: COMMD10
Antibody Type: Monoclonal Antibody
HPA054156-100ul