Anti-IDUA
Catalog Number:
ATA-HPA054254
- Images (8)
| Article Name: | Anti-IDUA |
| Biozol Catalog Number: | ATA-HPA054254 |
| Supplier Catalog Number: | HPA054254 |
| Alternative Catalog Number: | ATA-HPA054254-100,ATA-HPA054254-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MPS1 |
| iduronidase, alpha-L- |
| Anti-IDUA |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 3425 |
| UniProt: | P35475 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | IDUA |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human stomach and skeletal muscle tissues using HPA054254 antibody. Corresponding IDUA RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human prostate shows strong positivity in cytoplasm granular in glandular cells. |
|
|
Immunohistochemical staining of human rectum shows strong positivity in cytoplasm granular in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows low positivity as expected. |
|
|
Immunohistochemical staining of human stomach shows strong positivity in cytoplasm granular in glandular cells. |
|
|
HPA054254-100ul |
|
|
HPA054254-100ul |
|
|
HPA054254-100ul |
Product Guarantee and Expert Support
