Anti-NTPCR
Catalog Number:
ATA-HPA054304
- Images (4)
| Article Name: | Anti-NTPCR |
| Biozol Catalog Number: | ATA-HPA054304 |
| Supplier Catalog Number: | HPA054304 |
| Alternative Catalog Number: | ATA-HPA054304-100,ATA-HPA054304-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Molekularbiologie |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C1orf57, HCR-NTPase, MGC13186 |
| nucleoside-triphosphatase, cancer-related |
| Anti-NTPCR |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 84284 |
| UniProt: | Q9BSD7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NTPCR |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. |
|
|
Immunohistochemical staining of human adrenal gland shows cytoplasmic positivity in glandular cells. |
|
|
HPA054304-100ul |
|
|
HPA054304-100ul |
Product Guarantee and Expert Support
