Anti-PWWP3A

Catalog Number: ATA-HPA054491
Article Name: Anti-PWWP3A
Biozol Catalog Number: ATA-HPA054491
Supplier Catalog Number: HPA054491
Alternative Catalog Number: ATA-HPA054491-100,ATA-HPA054491-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: EXPAND1, MUM-1, MUM1
Clonality: Polyclonal
Concentration: 0,2
NCBI: 84939
UniProt: Q2TAK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PVRKSIQQDVLGTKLPQLSKGSPEEPVVGCPLGQRQPCRKMLPDRSRAARDRANQKLVEYIVKAKGAESHLRAILKSRKPSRW
Target: PWWP3A
HPA054491-100ul