Anti-RFTN1

Catalog Number: ATA-HPA054662
Article Name: Anti-RFTN1
Biozol Catalog Number: ATA-HPA054662
Supplier Catalog Number: HPA054662
Alternative Catalog Number: ATA-HPA054662-100,ATA-HPA054662-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ23866, KIAA0084, MIG2, Raftlin
Clonality: Polyclonal
Concentration: 0,5
NCBI: 23180
UniProt: Q14699
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VSKTLDGPESNPLEVHEEPLSGKMEIFTLFNKPKSHQKCRQYYPVTIPLHVSKNGQTVSGLDANWLEHMSDHFRKGGML
Target: RFTN1
HPA054662-100ul