Anti-ERMAP

Catalog Number: ATA-HPA054672
Article Name: Anti-ERMAP
Biozol Catalog Number: ATA-HPA054672
Supplier Catalog Number: HPA054672
Alternative Catalog Number: ATA-HPA054672-100,ATA-HPA054672-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BTN5, RD, SC
Clonality: Polyclonal
Isotype: IgG
NCBI: 114625
UniProt: Q96PL5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPD
Target: ERMAP
Antibody Type: Monoclonal Antibody
HPA054672-100ul